MPG antibody (Middle Region)
-
- Target See all MPG Antibodies
- MPG (N-Methylpurine-DNA Glycosylase (MPG))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MPG antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MPG antibody was raised against the middle region of MPG
- Purification
- Affinity purified
- Immunogen
- MPG antibody was raised using the middle region of MPG corresponding to a region with amino acids QRDLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGS
- Top Product
- Discover our top product MPG Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MPG Blocking Peptide, catalog no. 33R-7705, is also available for use as a blocking control in assays to test for specificity of this MPG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MPG (N-Methylpurine-DNA Glycosylase (MPG))
- Alternative Name
- MPG (MPG Products)
- Synonyms
- AAG antibody, ADPG antibody, APNG antibody, CRA36.1 antibody, MDG antibody, Mid1 antibody, PIG11 antibody, PIG16 antibody, anpg antibody, 9830006D05 antibody, AI326268 antibody, Aag antibody, zgc:162984 antibody, si:xx-187g17.9 antibody, MPG antibody, MPGR antibody, N-methylpurine DNA glycosylase antibody, N-methylpurine-DNA glycosylase antibody, si:xx-by187g17.9 antibody, MPG antibody, Mpg antibody, mpg antibody, si:xx-by187g17.9 antibody, CpB0526 antibody, gll2491 antibody
- Background
- MPG functions in the hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions.
- Molecular Weight
- 31 kDa (MW of target protein)
- Pathways
- DNA Damage Repair
-