Cytochrome b antibody (N-Term)

Catalog No. ABIN635601

Product Details anti-Cytochrome b Antibody

Target: Cytochrome b (MT-CYB) (Mitochondrially Encoded Cytochrome B (MT-CYB))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cytochrome b antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYTB antibody was raised against the N terminal of CYTB

Purification: Affinity purified

Immunogen: CYTB antibody was raised using the N terminal of CYTB corresponding to a region with amino acids TPMRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYTB Blocking Peptide, catalog no. 33R-9225, is also available for use as a blocking control in assays to test for specificity of this CYTB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYTB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cytochrome b

Target: Cytochrome b (MT-CYB) (Mitochondrially Encoded Cytochrome B (MT-CYB))

Alternative Name: CYTB (MT-CYB Products)

Synonyms: cytB antibody, cytb antibody, MTCYB antibody, cytochrome b antibody, CYTB antibody

Background: CYTB belongs to the cytochrome b family. It is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Proton Transport