PAM antibody (N-Term)

Catalog No. ABIN635741

The Rabbit Polyclonal anti-PAM antibody is suitable to detect PAM in samples from Human. It has been validated for WB.

Quick Overview for PAM antibody (N-Term) (ABIN635741)

Target: PAM (Peptidylglycine alpha-Amidating Monooxygenase (PAM))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAM antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PAM Antibody

Binding Specificity: N-Term

Specificity: PAM antibody was raised against the N terminal of PAM

Purification: Affinity purified

Immunogen: PAM antibody was raised using the N terminal of PAM corresponding to a region with amino acids PKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PAM Blocking Peptide, (ABIN5615206), is also available for use as a blocking control in assays to test for specificity of this PAM antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PAM

Target: PAM (Peptidylglycine alpha-Amidating Monooxygenase (PAM))

Alternative Name: PAM

Background: PAM is a multifunctional protein. It has two enzymatically active domains with catalytic activities-peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products.

Molecular Weight: 108 kDa (MW of target protein)