FLT3LG antibody (N-Term)

Catalog No. ABIN635754

Product Details anti-FLT3LG Antibody

Target: FLT3LG (Fms-Related tyrosine Kinase 3 Ligand (FLT3LG))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FLT3LG antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Flt3 Ligand antibody was raised against the N terminal of FLT3 LG

Purification: Affinity purified

Immunogen: Flt3 Ligand antibody was raised using the N terminal of FLT3 LG corresponding to a region with amino acids TVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Flt3 Ligand Blocking Peptide, catalog no. 33R-9360, is also available for use as a blocking control in assays to test for specificity of this Flt3 Ligand antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLT0 G antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FLT3LG

Target: FLT3LG (Fms-Related tyrosine Kinase 3 Ligand (FLT3LG))

Alternative Name: Flt3 Ligand (FLT3LG Products)

Synonyms: Flt3lg antibody, Ly72L antibody, FL antibody, FLT3L antibody, Vegfr3 antibody, fms related tyrosine kinase 3 ligand antibody, FMS-like tyrosine kinase 3 ligand antibody, fms-related tyrosine kinase 4 antibody, fms-related tyrosine kinase 3 ligand antibody, FLT3LG antibody, Flt3l antibody, Flt4 antibody, Flt3lg antibody

Background: FLT3LG stimulates the proliferation of early hematopoietic cells and synergizes well with a number of other colony stimulating factors and interleukins.

Molecular Weight: 26 kDa (MW of target protein)

Pathways: RTK Signaling