TSPAN12 antibody (Middle Region)

Catalog No. ABIN635761

This Rabbit Polyclonal antibody specifically detects TSPAN12 in WB. It exhibits reactivity toward Human, Rat, Mouse and Dog.

Quick Overview for TSPAN12 antibody (Middle Region) (ABIN635761)

Target: TSPAN12 (Tetraspanin 12 (TSPAN12))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TSPAN12 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TSPAN12 Antibody

Binding Specificity: Middle Region

Specificity: Tetraspanin 12 antibody was raised against the middle region of TSPAN12

Purification: Affinity purified

Immunogen: Tetraspanin 12 antibody was raised using the middle region of TSPAN12 corresponding to a region with amino acids EFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQ

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tetraspanin 12 Blocking Peptide, (ABIN937796), is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TSPAN12

Target: TSPAN12 (Tetraspanin 12 (TSPAN12))

Alternative Name: Tetraspanin 12

Background: TSPAN12 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Molecular Weight: 35 kDa (MW of target protein)