FCRLA antibody (C-Term)

Catalog No. ABIN635774

Product Details anti-FCRLA Antibody

Target: FCRLA (Fc Receptor-Like A (FCRLA))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FCRLA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FCRLA antibody was raised against the C terminal of FCRLA

Purification: Affinity purified

Immunogen: FCRLA antibody was raised using the C terminal of FCRLA corresponding to a region with amino acids MPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHRKPGTTKATAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FCRLA Blocking Peptide, catalog no. 33R-6273, is also available for use as a blocking control in assays to test for specificity of this FCRLA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCRLA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FCRLA

Target: FCRLA (Fc Receptor-Like A (FCRLA))

Alternative Name: FCRLA (FCRLA Products)

Synonyms: FCRL antibody, FCRL1 antibody, FCRLM1 antibody, FCRLX antibody, FCRLb antibody, FCRLc1 antibody, FCRLc2 antibody, FCRLd antibody, FCRLe antibody, FCRX antibody, FREB antibody, BB219290 antibody, Fcrlm1 antibody, Fcrx antibody, Freb1 antibody, mFREB antibody, mFcrX antibody, RGD1306176 antibody, Fc receptor like A antibody, Fc receptor-like A antibody, FCRLA antibody, Fcrla antibody

Background: Receptors for the Fc fragment of IgG, or FCGRs, are cell surface glycoproteins of the Ig superfamily (IgSF). These receptors mediate phagocytosis of IgG-coated pathogens and promote activation of effector cells, leading to inflammatory responses and antibody-mediated cellular cytotoxicity. FCRLA may be implicated in B-cell differentiation and lymphomagenesis.

Molecular Weight: 41 kDa (MW of target protein)