GNS antibody (C-Term)

Catalog No. ABIN635775

Product Details anti-GNS Antibody

Target: GNS (Glucosamine (N-Acetyl)-6-Sulfatase (GNS))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GNS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GNS antibody was raised against the C terminal of GNS

Purification: Affinity purified

Immunogen: GNS antibody was raised using the C terminal of GNS corresponding to a region with amino acids PILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GNS Blocking Peptide, catalog no. 33R-7159, is also available for use as a blocking control in assays to test for specificity of this GNS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GNS

Target: GNS (Glucosamine (N-Acetyl)-6-Sulfatase (GNS))

Alternative Name: GNS (GNS Products)

Synonyms: G6S antibody, 2610016K11Rik antibody, AU042285 antibody, C87209 antibody, N28088 antibody, NV14559 antibody, N-acetylglucosamine-6-sulfatase antibody, zgc:114066 antibody, gns antibody, wu:fi20h10 antibody, zgc:55370 antibody, glucosamine (N-acetyl)-6-sulfatase antibody, glucosamine (N-acetyl)-6-sulfatase S homeolog antibody, glucosamine (N-acetyl)-6-sulfatase a antibody, N-acetylglucosamine-6-sulfatase antibody, glucosamine (N-acetyl)-6-sulfatase (Sanfilippo disease IIID), b antibody, GNS antibody, Gns antibody, gns.S antibody, gns antibody, gnsa antibody, CpipJ_CPIJ000745 antibody, Sros_7372 antibody, VDBG_04409 antibody, Halhy_3165 antibody, gnsb antibody

Background: GNS is a lysosomal enzyme found in all cells. It is involved in the catabolism of heparin, heparin sulphate, and keratan sulphate. Deficiency of this enzyme results in the accumulation of undegraded substrate and the lysosomal storage disorder ucopolysaccharidosis type IIID (Sanfilippo D syndrome). Mucopolysaccharidosis type IIID is the least common of the four subtypes of Sanfilippo syndrome.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process