ADAM19 antibody

Catalog No. ABIN635789

Product Details anti-ADAM19 Antibody

Target: ADAM19 (Adam19) (ADAM Metallopeptidase Domain 19 (Adam19))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAM19 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADAM19 Blocking Peptide, catalog no. 33R-3525, is also available for use as a blocking control in assays to test for specificity of this ADAM19 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADAM19

Target: ADAM19 (Adam19) (ADAM Metallopeptidase Domain 19 (Adam19))

Alternative Name: ADAM19 (Adam19 Products)

Synonyms: AL024287 antibody, M[b] antibody, Mltnb antibody, MADDAM antibody, MLTNB antibody, Sox30 antibody, fksg34 antibody, maddam antibody, mltnb antibody, a disintegrin and metallopeptidase domain 19 (meltrin beta) antibody, ADAM metallopeptidase domain 19 antibody, ADAM metallopeptidase domain 19 S homeolog antibody, Adam19 antibody, ADAM19 antibody, adam19.S antibody

Background: ADAM19 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation.

Molecular Weight: 82 kDa (MW of target protein)