CA4 antibody (C-Term)

Catalog No. ABIN635852

The Rabbit Polyclonal anti-CA4 antibody is suitable to detect CA4 in samples from Human. It has been validated for WB.

Quick Overview for CA4 antibody (C-Term) (ABIN635852)

Target: CA4 (Carbonic Anhydrase IV (CA4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CA4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CA4 Antibody

Binding Specificity: C-Term

Specificity: Carbonic Anhydrase IV antibody was raised against the C terminal of CA4

Purification: Affinity purified

Immunogen: Carbonic Anhydrase IV antibody was raised using the C terminal of CA4 corresponding to a region with amino acids AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carbonic Anhydrase IV Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase IV antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CA4

Target: CA4 (Carbonic Anhydrase IV (CA4))

Alternative Name: Carbonic Anhydrase IV

Background: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA4 is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known.

Molecular Weight: 34 kDa (MW of target protein)