MUC1 antibody (N-Term)

Catalog No. ABIN635866

This Rabbit Polyclonal antibody specifically detects MUC1 in WB. It exhibits reactivity toward Human.

Quick Overview for MUC1 antibody (N-Term) (ABIN635866)

Target: MUC1 (Mucin 1 (MUC1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MUC1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MUC1 Antibody

Binding Specificity: N-Term

Specificity: MUC1 antibody was raised against the N terminal of MUC1

Purification: Affinity purified

Immunogen: MUC1 antibody was raised using the N terminal of MUC1 corresponding to a region with amino acids SATQRSSVPSSTEKNALSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MUC1 Blocking Peptide, (ABIN5614880), is also available for use as a blocking control in assays to test for specificity of this MUC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MUC1

Target: MUC1 (Mucin 1 (MUC1))

Alternative Name: MUC1

Background: MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Negative Regulation of intrinsic apoptotic Signaling