UGT1A9 antibody (N-Term)

Catalog No. ABIN636089

Product Details anti-UGT1A9 Antibody

Target: UGT1A9 (UDP Glucuronosyltransferase 1 Family, Polypeptide A9 (UGT1A9))

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UGT1A9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UGT1 A9 antibody was raised against the N terminal of µgT1 9

Purification: Affinity purified

Immunogen: UGT1 A9 antibody was raised using the N terminal of µgT1 9 corresponding to a region with amino acids LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UGT1A9 Blocking Peptide, catalog no. 33R-5168, is also available for use as a blocking control in assays to test for specificity of this µgT1A9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UGT1A9

Target: UGT1A9 (UDP Glucuronosyltransferase 1 Family, Polypeptide A9 (UGT1A9))

Alternative Name: UGT1A9 (UGT1A9 Products)

Synonyms: UGT1A9 antibody, DKFZP469N0814 antibody, SHEUGT1A07 antibody, HLUGP4 antibody, LUGP4 antibody, UDPGT antibody, UDPGT 1-9 antibody, UGT-1I antibody, UGT1-09 antibody, UGT1-9 antibody, UGT1.9 antibody, UGT1AI antibody, UGT1I antibody, UGTP4 antibody, Ugt1a12 antibody, mUGTBr/P antibody, Ugt1a10 antibody, Ugt1a11 antibody, UDP glycosyltransferase 1 family, polypeptide A9 antibody, UDP glucuronosyltransferase 1 family, polypeptide A9 antibody, UDP glucuronosyltransferase family 1 member A9 antibody, UGT1A9 antibody, Ugt1a9 antibody

Background: UGT1A9 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. UGT1A9 is active on phenols.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha