EWSR1 antibody (Middle Region)

Catalog No. ABIN6719313

Product Details anti-EWSR1 Antibody

Target: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Binding Specificity: AA 369-399, Middle Region

Reactivity: Human, Mouse, Monkey

Host: Mouse

Clonality: Monoclonal

Conjugate: This EWSR1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Mouse IgG monoclonal antibody for EWSR1 detection. Tested with WB, IHC-P in Human,Mouse,Monkey.

Sequence: NDSVTLDDLA DFFKQCGVVK MNKRTGQPMI H

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Mouse IgG monoclonal antibody for EWSR1 detection. Tested with WB, IHC-P in Human,Mouse,Monkey.

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.

Clone: 4B4

Isotype: IgG

Application Details

Application Notes:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL

Comment:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for EWSR1

Target: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Alternative Name: EWSR1 (EWSR1 Products)

Synonyms: EWS antibody, bK984G1.4 antibody, AU018891 antibody, Ews antibody, Ewsh antibody, EWSR1 antibody, fc04c01 antibody, wu:fc04c01 antibody, DKFZp459K1116 antibody, ewsr1 antibody, ewsr1.S antibody, fb40b11 antibody, fusl antibody, wu:fb40b11 antibody, wu:fb75g09 antibody, zgc:55864 antibody, EWS RNA binding protein 1 antibody, Ewing sarcoma breakpoint region 1 antibody, EWS RNA-binding protein 1 antibody, EWS RNA-binding protein 1a antibody, EWS RNA binding protein 1 L homeolog antibody, EWS RNA-binding protein 1b antibody, EWSR1 antibody, Ewsr1 antibody, ewsr1a antibody, ewsr1 antibody, ewsr1.L antibody, ewsr1b antibody

Background:

Synonyms: RNA-binding protein EWS, EWS oncogene, Ewing sarcoma breakpoint region 1 protein, EWSR1, EWS

Background: This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.

Gene ID: 2130

UniProt: Q01844