ENO2/NSE antibody (AA 2-285)

Catalog No. ABIN7427918

This anti-ENO2/NSE antibody is a Mouse Monoclonal antibody detecting ENO2/NSE in WB, IHC, IP and ICC. Suitable for Human.

Quick Overview for ENO2/NSE antibody (AA 2-285) (ABIN7427918)

Target: ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This ENO2/NSE antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC)

Clone: C10

Product Details anti-ENO2/NSE Antibody

Binding Specificity: AA 2-285

Purpose: Monoclonal Antibody to Enolase, Neuron Specific (NSE)

Specificity: The antibody is a mouse monoclonal antibody raised against NSE. It has been selected for its ability to recognize NSE in immunohistochemical staining and western blotting.

Cross-Reactivity: Mouse, Rat

Purification: Protein A + Protein G affinity chromatography

Immunogen: Recombinant Enolase, Neuron Specific (NSE) corresdonding to Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT with N-terminal His Tag

Isotype: IgG2b kappa

Application Details

Application Notes: Western blotting: 0.5-2 μg/mL,Immunohistochemistry: 5-20 μg/mL,Immunocytochemistry: 5-20 μg/mL,Optimal working dilutions must be determined by end user.

Comment:

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 1 mg/mL

Buffer: PBS, pH 7.4, containing 0.02 % Sodium azide, 50 % glycerol.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Expiry Date: 24 months

Target Details for ENO2/NSE

Target: ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))

Alternative Name: Enolase, Neuron Specific

Background: ENO2, Enolase 2, Gamma Enolase, 2-phospho-D-glycerate hydro-lyase, Neural enolase

UniProt: P09104