KCNJ1 antibody (AA 342-391)

Catalog No. ABIN7043467

This Rabbit Polyclonal antibody specifically detects KCNJ1 in WB, IF, IHC, IC and IP. It exhibits reactivity toward Rat.

Quick Overview for KCNJ1 antibody (AA 342-391) (ABIN7043467)

Target: KCNJ1 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 1 (KCNJ1))

Reactivity: Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNJ1 antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunochromatography (IC), Immunoprecipitation (IP)

Grade: KO Validated

Product Details anti-KCNJ1 Antibody

Binding Specificity: AA 342-391

Purpose: A Rabbit Polyclonal Antibody to KCNJ1 (Kir1.1) Channel

Specificity: Intracellular, C-terminus

Cross-Reactivity: Human, Mouse, Rat

Predicted Reactivity: Mouse - identical, human - 45,50 amino acid residues identical

Characteristics: Anti-KCNJ1 (Kir1.1) Antibody (ABIN7043467, ABIN7044897 and ABIN7044898) is a highly specific antibody directed against an epitope of the rat potassium channel ROM-K. The antibody can be used in western blot, immunohistochemistry, immunocytochemistry, and immunoprecipitation applications. It has been designed to recognize ROMK1 from rat, mouse, and human samples.

Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Immunogen:

Immunogen: GST fusion protein

Immunogen Sequence: GST fusion protein with the sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat KCNJ1

Isotype: IgG

Application Details

Application Notes:

Antigen preadsorption control: 3 μg fusion protein per 1 μg antibody

Application Dilutions Immunohistochemistry paraffin embedded sections ihc: N/A

Application Dilutions Western blot wb: 1:200

Comment:

Cited Application: IP

Negative Control: (ABIN7236357)

Blocking Peptide: (ABIN7236357)

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: 0.2 mL double distilled water (DDW).

Concentration: 1 mg/mL

Buffer: PBS pH 7.4

Storage: 4 °C,-20 °C

Storage Comment:

Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.

Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Target Details for KCNJ1

Target: KCNJ1 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 1 (KCNJ1))

Alternative Name: KCNJ1

Background: ROMK1, ATP-sensitive inward rectifier potassium channel 1,Kir1.1 (KCNJ1, ROMK1) was the first member of the family of inward rectifying K+ channels to be cloned.1 The family includes 15 members that are structurally and functionally different from the voltage-dependent K+ channels.The family's topology consists of two transmembrane domains that flank a single and highly conserved pore region with intracellular N- and C-termini. As is the case for the voltage-dependent K+ channels, the functional unit for the Kir channel is composed of four subunits that can assemble as either homo or heterotetramers.Kir channels are characterized by a K+ efflux that is limited by depolarizing membrane potentials thus making them essential for controlling resting membrane potential and K+ homeostasis.3As its original name indicates (ROMK1, Renal Outer Medullary K+ channel), Kir1.1 is strongly expressed in the kidney in the apical membrane of several kidney segments such as the thick ascending loop of Henle (TAL) and the cortical collecting duct (CCD). In addition, the channel is also expressed in the brain, mainly in the cortex and hippocampus.3Kir1.1 plays a key role in K+ recycling in the loop of Henle. Indeed, loss-of-function mutations in the Kir1.1 gene cause Bartter's syndrome type II, a recessive autosomal disease characterized by the impairment of K+ efflux and the subsequent inability of the NKCC2 transporter to continue NaCl uptake. This leads to a high salt concentration in the urine that induces osmotic diuresis and low plasma volume.2 Pharmacologically, the Kir1.1 channel can be inhibited by several general K+ channel blockers such as Tertiapin (#STT-250), however the scorpion toxin Lq2 (#RTL-550) specifically and potently inhibits Kir1.1 channels.4

Alternative names: KCNJ1 (Kir1.1), ROMK1, ATP-sensitive inward rectifier potassium channel 1

Gene ID: 24521

NCBI Accession: NM_000220

UniProt: P35560