KCNJ1 antibody (C-Term, Intracellular)

Catalog No. ABIN7043467

Product Details anti-KCNJ1 Antibody

Target: KCNJ1 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 1 (KCNJ1))

Binding Specificity: AA 342-391, C-Term, Intracellular

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNJ1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunoprecipitation (IP)

Characteristics: Anti-KCNJ1 (Kir1.1) Antibody (ABIN7043467, ABIN7044897 and ABIN7044898)) is a highly specific antibody directed against an epitope of the rat potassium channel ROM-K. The antibody can be used in western blot, immunohistochemistry, immunocytochemistry, and immunoprecipitation applications. It has been designed to recognize ROMK1 from rat, mouse, and human samples.

Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Immunogen:

Immunogen: GST fusion protein

Immunogen Sequence: GST fusion protein with the sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat KCNJ1

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: 25 μL, 50 μL or 0.2 mL double distilled water (DDW), depending on the sample size.

Concentration: 0.8 mg/mL

Buffer: Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1 % BSA, 0.05 % Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: RT,4 °C,-20 °C

Storage Comment:

Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.

Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Target Details for KCNJ1

Target: KCNJ1 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 1 (KCNJ1))

Alternative Name: KCNJ1 (Kir1.1) (KCNJ1 Products)

Synonyms: KIR1.1 antibody, ROMK antibody, ROMK1 antibody, kir1.1 antibody, romk1 antibody, Kcnj antibody, Kir1.1 antibody, Romk2 antibody, kcnj1 antibody, wu:fl37c05 antibody, zgc:63534 antibody, potassium voltage-gated channel subfamily J member 1 antibody, potassium voltage-gated channel subfamily J member 1 L homeolog antibody, potassium inwardly-rectifying channel, subfamily J, member 1 antibody, potassium inwardly-rectifying channel, subfamily J, member 1a, tandem duplicate 1 antibody, KCNJ1 antibody, kcnj1.L antibody, kcnj1 antibody, Kcnj1 antibody, kcnj1a.1 antibody

Background: Alternative names: KCNJ1 (Kir1.1), ROMK1, ATP-sensitive inward rectifier potassium channel 1

Gene ID: 24521

NCBI Accession: NM_000220

UniProt: P35560