HSPA9 antibody (C-Term)

Catalog No. ABIN7877395

The Mouse Monoclonal anti-HSPA9 antibody (Clone 4I9) (ABIN7877395) specifically detects HSPA9 in WB, IF, FACS and IHC (p). The antibody is reactive with Human, Rat and Mouse samples.

Quick Overview for HSPA9 antibody (C-Term) (ABIN7877395)

Target: HSPA9 (Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9))

Reactivity: Human, Rat, Mouse

Host: Mouse

Clonality: Monoclonal

Conjugate: This HSPA9 antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 4I9

Product Details anti-HSPA9 Antibody

Binding Specificity: C-Term

Purpose: HSPA9 Antibody / GRP75

Sequence: KLFEMAYKKM ASEREGSGSS GTGEQKEDQK EEKQ

Purification: Affinity purified

Immunogen: C-terminal region amino acids KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ from the human protein were used as the immunogen for the HSPA9 antibody.

Isotype: IgG1

Application Details

Application Notes: Optimal dilution of the HSPA9 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the HSPA9 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for HSPA9

Target: HSPA9 (Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9))

Alternative Name: HSPA9

Background: HSPA9 (heat shock 70 kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation.

UniProt: P38646