HSPA9 antibody (C-Term)

Catalog No. ABIN3043853

Product Details anti-HSPA9 Antibody

Target: HSPA9 (Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9))

Binding Specificity: AA 646-679, C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSPA9 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Stress-70 protein, mitochondrial(HSPA9) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: KLFEMAYKKM ASEREGSGSS GTGEQKEDQK EEKQ

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Stress-70 protein, mitochondrial(HSPA9) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: heat shock 70 kDa protein 9 (mortalin)
Protein Name: Stress-70 protein, mitochondrial

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for HSPA9

Target: HSPA9 (Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9))

Alternative Name: HSPA9 (HSPA9 Products)

Synonyms: APG-2 antibody, HS24/P52 antibody, HSPH2 antibody, RY antibody, hsp70 antibody, hsp70RY antibody, CSA antibody, GRP-75 antibody, GRP75 antibody, HSPA9B antibody, MOT antibody, MOT2 antibody, MTHSP75 antibody, PBP74 antibody, Hspa9a antibody, csa antibody, grp-75 antibody, grp75 antibody, hspa9 antibody, hspa9b antibody, mortalin antibody, mot antibody, mot2 antibody, pbp74 antibody, mot-2 antibody, mthsp75 antibody, 74kDa antibody, Csa antibody, Grp75 antibody, Hsc74 antibody, Hsp74 antibody, Hsp74a antibody, Mortalin antibody, Mot-2 antibody, Mot2 antibody, Mthsp70 antibody, Pbp74 antibody, cb740 antibody, crs antibody, wu:fc14d08 antibody, wu:fc27c10 antibody, wu:fc38a06 antibody, heat shock protein family A (Hsp70) member 4 antibody, heat shock protein family A (Hsp70) member 9 antibody, heat shock protein family A member 9 antibody, heat shock protein family A (Hsp70) member 9 S homeolog antibody, stress-70 protein, mitochondrial antibody, heat shock protein 9 antibody, heat shock protein Hsp9 antibody, HSPA4 antibody, HSPA9 antibody, Hspa9 antibody, hspa9.S antibody, hspa9 antibody, LOC577721 antibody, hsp9 antibody

Background: HSPA9 (heat shock 70 kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation.

Synonyms: 75 kDa glucose regulated protein antibody|75 kDa glucose-regulated protein antibody|CSA antibody|Glucose Regulated Protein antibody| Grp 75 antibody|GRP-75 antibody|GRP75 antibody| GRP75_HUMAN antibody|Heat shock 70 kDa protein 9 antibody|Heat shock 70kD protein 9 antibody|heat shock 70 kDa protein 9 antibody|Heat shock 70 kDa protein 9B antibody|Heat shock protein 74 kDa A antibody|Heat shock protein A antibody|Heat shock protein cognate 74 antibody|Hsc74 antibody|Hsp74 antibody|Hsp74a antibody|HSPA9 antibody|Hspa9a antibody|HSPA9B antibody|MGC4500 antibody|mitochondrial antibody|Mortalin 2 antibody|Mortalin antibody|Mortalin perinuclear antibody| Mortalin2 antibody|MOT 2 antibody|MOT antibody|MOT2 antibody|Mthsp70 antibody|p66 mortalin antibody|P66 MOT antibody|PBP74 antibody| Peptide binding protein 74 antibody|Peptide-binding protein 74 antibody|Stress 70 protein mitochondrial antibody|Stress 70 protein mitochondrial precursor antibody|Stress-70 protein antibody

Gene ID: 3313

UniProt: P38646