PDIA3 antibody (C-Term)

Catalog No. ABIN7877463

The Mouse Monoclonal anti-PDIA3 antibody is suitable to detect PDIA3 in samples from Human. It has been validated for WB, IHC (p) and FACS.

Quick Overview for PDIA3 antibody (C-Term) (ABIN7877463)

Target: PDIA3 (Protein Disulfide Isomerase Family A, Member 3 (PDIA3))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This PDIA3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Clone: 7E5-

Product Details anti-PDIA3 Antibody

Binding Specificity: C-Term

Purpose: ERp57 Antibody / PDIA3

Sequence: RELSDFISYL QREATNPPVI QEEKPKKKKK AQEDL

Purification: Antigen affinity purified

Immunogen: C-terminal amino acids RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL were used as the immunogen for the ERp57 antibody.

Isotype: IgG1

Application Details

Application Notes: Optimal dilution of the ERp57 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the ERp57 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for PDIA3

Target: PDIA3 (Protein Disulfide Isomerase Family A, Member 3 (PDIA3))

Alternative Name: ERp57

Background: PDIA3 (Protein disulfide isomerase family A, member 3), also called GRP58, Erp57 or ER60, is an isomerase enzyme. It is mapped on 15q15.3. PDIA3 is also part of the major histocompatibility complex (MHC) class I peptide-loading complex, which is essential for formation of the final antigen conformation and export from the endoplasmic reticulum to the cell surface. This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase, however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates.

UniProt: P30101

Pathways: Maintenance of Protein Location, Protein targeting to Nucleus, Cell RedoxHomeostasis