SOD2 antibody (C-Term)

Catalog No. ABIN7877480

This Mouse Monoclonal antibody specifically detects SOD2 in WB and IHC (p). It exhibits reactivity toward Human and Mouse.

Quick Overview for SOD2 antibody (C-Term) (ABIN7877480)

Target: SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))

Reactivity: Human, Mouse

Host: Mouse

Clonality: Monoclonal

Conjugate: This SOD2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 2B12B1

Product Details anti-SOD2 Antibody

Binding Specificity: C-Term

Purpose: Superoxide Dismutase 2 Antibody / SOD2

Sequence: QYKNVRPDYL KAIWNVINWE NVTERYMACK K

Purification: Antigen affinity purified

Immunogen: C-terminal amino acids QYKNVRPDYLKAIWNVINWENVTERYMACKK were used as the immunogen for the Superoxide Dismutase 2 antibody.

Isotype: IgG2b

Application Details

Application Notes: Optimal dilution of the Superoxide Dismutase 2 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the Superoxide Dismutase 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for SOD2

Target: SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))

Alternative Name: Superoxide Dismutase 2

Background: SOD2 (Superoxide Dismutase 2), also called IPO-B or MNSOD, is a mitochondrial matrix enzyme that scavenges oxygen radicals produced by the extensive oxidation-reduction and electron transport reactions occurring in mitochondria. This gene is a member of the iron/manganese superoxide dismutase family. Using a somatic cell hybrid panel containing different segments of chromosome 6, they demonstrated that SOD2 is located in the region 6q25.3-qter which, together with the FISH analysis, indicated that SOD2 is in the distal portion of 6q25. The SOD2 gene encodes an intramitochondrial free radical scavenging enzyme that is the first line of defense against superoxide produced as a byproduct of oxidative phosphorylation. Adeno-associated viral delivery of the human SOD2 gene resulted in suppression of optic nerve degeneration and rescue of retinal ganglion cells. The findings suggested that reactive oxygen species contributed to retinal cell death and optic nerve damage in mice with complex I deficiency, and that expression of SOD2 attenuated the disease process.

UniProt: P04179

Pathways: Sensory Perception of Sound, Transition Metal Ion Homeostasis, Negative Regulation of intrinsic apoptotic Signaling