14-3-3 zeta antibody

Catalog No. ABIN7879844

This Mouse Monoclonal antibody specifically detects 14-3-3 zeta in WB. It exhibits reactivity toward Human, Mouse, Rat and Monkey.

Quick Overview for 14-3-3 zeta antibody (ABIN7879844)

Target: 14-3-3 zeta (YWHAZ)

Reactivity: Human, Mouse, Rat, Monkey

Host: Mouse

Clonality: Monoclonal

Conjugate: This 14-3-3 zeta antibody is un-conjugated

Application: Western Blotting (WB)

Clone: 6H7

Product Details anti-14-3-3 zeta Antibody

Purpose: 14-3-3 zeta/delta Antibody / YWHAZ

Sequence: LLEKFLIPNA SQAESKVFYL KMKGDYYRYL AEVAAGDDKK GIVDQ

Purification: Affinity purified

Immunogen: Amino acids LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ from the human protein were used as the immunogen for the 14-3-3 zeta/delta antibody.

Isotype: IgG1

Application Details

Application Notes: Optimal dilution of the 14-3-3 zeta/delta antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the 14-3-3 zeta/delta antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for 14-3-3 zeta

Target: 14-3-3 zeta (YWHAZ)

Alternative Name: 14-3-3 zeta/delta

Background: 14-3-3 protein zeta/delta is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99 % identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.

UniProt: P63104

Pathways: Apoptosis, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location