ALDH2 antibody

Catalog No. ABIN7879939

The Mouse Monoclonal anti-ALDH2 antibody (Clone 5G7) (ABIN7879939) specifically detects ALDH2 in WB, FACS and IF. The antibody is reactive with Human, Rat and Mouse samples.

Quick Overview for ALDH2 antibody (ABIN7879939)

Target: ALDH2 (Aldehyde Dehydrogenase 2 Family (Mitochondrial) (ALDH2))

Reactivity: Human, Rat, Mouse

Host: Mouse

Clonality: Monoclonal

Conjugate: This ALDH2 antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunofluorescence (IF)

Clone: 5G7

Product Details anti-ALDH2 Antibody

Purpose: ALDH2 Antibody

Sequence: SAAATQAVPA PNQQPEVFCN QIFINNEWHD A

Purification: Affinity purified

Immunogen: Amino acids SAAATQAVPAPNQQPEVFCNQIFINNEWHDA were used as the immunogen for the ALDH2 antibody.

Isotype: IgG2a

Application Details

Application Notes: Optimal dilution of the ALDH2 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the ALDH2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for ALDH2

Target: ALDH2 (Aldehyde Dehydrogenase 2 Family (Mitochondrial) (ALDH2))

Alternative Name: ALDH2

Background: ALDH2 (Aldehyde Dehydrogenase 2 Family) is a human gene. The enzyme encoded by this gene belongs to the aldehyde dehydrogenase family of enzymes that catalyze the chemical transformation from acetaldehyde to acetic acid. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Hsu et al. (1985) assigned the ALDH2 locus to chromosome 12 by means of a cDNA probe and Southern blot analysis of somatic cell hybrids. Using an unbiased proteomic search, Chen et al. (2008) identified mitochondrial ALDH2 as an enzyme whose activation correlated with reduced ischemic heart damage in rodent models. A high-throughput screen identified a small molecule activator of ALDH2, which they called Alda-1, that, when administered to rats before an ischemic event, reduced infarct size by 60 % , most likely through its inhibitory effect on the formation of cytotoxic aldehydes.

UniProt: P05091