ALKBH1 antibody

Catalog No. ABIN7879953

The Rabbit Polyclonal anti-ALKBH1 antibody is suitable to detect ALKBH1 in samples from Human. It has been validated for WB and IF.

Quick Overview for ALKBH1 antibody (ABIN7879953)

Target: ALKBH1 (AlkB, Alkylation Repair Homolog 1 (ALKBH1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALKBH1 antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF)

Product Details anti-ALKBH1 Antibody

Purpose: ALKBH1 Antibody

Sequence: YLKTARVNMT VRQVLATDQN FPLEPIEDEK RD

Purification: Affinity purified

Immunogen: Amino acids YLKTARVNMTVRQVLATDQNFPLEPIEDEKRD from the human protein were used as the immunogen for the ALKBH1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the ALKBH1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the ALKBH1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for ALKBH1

Target: ALKBH1 (AlkB, Alkylation Repair Homolog 1 (ALKBH1))

Alternative Name: ALKBH1

Background: Nucleic acid dioxygenase ALKBH1 is an enzyme that in humans is encoded by the ALKBH1 gene. It is mapped to 14q24.3. This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine.

UniProt: Q13686

Pathways: DNA Damage Repair