CXCR7 antibody

Catalog No. ABIN7880403

The Rabbit Polyclonal anti-CXCR7 antibody is suitable to detect CXCR7 in samples from Human. It has been validated for WB, FACS and IHC (p).

Quick Overview for CXCR7 antibody (ABIN7880403)

Target: CXCR7 (Chemokine (C-X-C Motif) Receptor 7 (CXCR7))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CXCR7 antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-CXCR7 Antibody

Purpose: CXCR7 Antibody

Sequence: RNYRYELMKA FIFKYSAKTG LTKLIDASRV SE

Purification: Antigen affinity purified

Immunogen: Amino acids RNYRYELMKAFIFKYSAKTGLTKLIDASRVSE from the human protein were used as the immunogen for the CXCR7 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the CXCR7 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the CXCR7 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for CXCR7

Target: CXCR7 (Chemokine (C-X-C Motif) Receptor 7 (CXCR7))

Alternative Name: CXCR7

Background: Atypical chemokine receptor 3 also known as C-X-C chemokine receptor type 7 (CXCR-7) and G-protein coupled receptor 159 (GPR159) is a protein that in humans is encoded by the ACKR3 gene. This gene encodes a member of the G-protein coupled receptor family. Although this protein was earlier thought to be a receptor for vasoactive intestinal peptide (VIP), it is now considered to be an orphan receptor, in that its endogenous ligand has not been identified. The protein is also a coreceptor for human immunodeficiency viruses (HIV). Translocations involving this gene and HMGA2 on chromosome 12 have been observed in lipomas.

UniProt: P25106

Pathways: Myometrial Relaxation and Contraction, Negative Regulation of intrinsic apoptotic Signaling