CHM antibody

Catalog No. ABIN7880414

This Rabbit Polyclonal antibody specifically detects CHM in WB, IF, FACS and IHC (p). It exhibits reactivity toward Human.

Quick Overview for CHM antibody (ABIN7880414)

Target: CHM (Choroideremia (Rab Escort Protein 1) (CHM))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHM antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-CHM Antibody

Purpose: CHM Antibody / Choroideremia protein

Sequence: QDQILENEEA IALSRKDKTI QHVEVFCYAS QDLHED

Purification: Antigen affinity purified

Immunogen: Amino acids QDQILENEEAIALSRKDKTIQHVEVFCYASQDLHED from the human protein were used as the immunogen for the CHM antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the CHM antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the CHM antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for CHM

Target: CHM (Choroideremia (Rab Escort Protein 1) (CHM))

Alternative Name: CHM

Background: Rab escort protein 1 (REP1) also known as Rab proteins geranylgeranyltransferase component A 1, and Choroideremia protein, is an enzyme that in humans is encoded by the CHM gene. It is mapped to Xq21.2. This gene encodes component A of the RAB geranylgeranyl transferase holoenzyme. In the dimeric holoenzyme, this subunit binds unprenylated Rab GTPases and then presents them to the catalytic Rab GGTase subunit for the geranylgeranyl transfer reaction. Rab GTPases need to be geranylgeranyled on either one or two cysteine residues in their C-terminus to localize to the correct intracellular membrane. Mutations in this gene are a cause of choroideremia, also known as tapetochoroidal dystrophy (TCD). This X-linked disease is characterized by progressive dystrophy of the choroid, retinal pigment epithelium and retina. Alternatively spliced transcript variants have been found for this gene.

UniProt: P24386

Pathways: Sensory Perception of Sound