Cyclin T1 antibody

Catalog No. ABIN7880530

The Mouse Monoclonal anti-Cyclin T1 antibody (Clone 3B7) (ABIN7880530) specifically detects Cyclin T1 in WB and FACS. The antibody is reactive with Human and Monkey samples.

Quick Overview for Cyclin T1 antibody (ABIN7880530)

Target: Cyclin T1 (CCNT1)

Reactivity: Human, Monkey

Host: Mouse

Clonality: Monoclonal

Conjugate: This Cyclin T1 antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS)

Clone: 3B7

Product Details anti-Cyclin T1 Antibody

Purpose: CCNT1 Antibody / Cyclin-T1

Sequence: QKQNSKSVPS AKVSLKEYRA KHAEELQKRQ LENM

Purification: Antigen affinity purified

Immunogen: Amino acids QKQNSKSVPSAKVSLKEYRAKHAEELQKRQLENM from the human protein were used as the immunogen for the CCNT1 antibody.

Isotype: IgG2b

Application Details

Application Notes: Optimal dilution of the CCNT1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the CCNT1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for Cyclin T1

Target: Cyclin T1 (CCNT1)

Alternative Name: CCNT1

Background: Cyclin-T1 is a protein that in humans is encoded by the CCNT1 gene. This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants.

UniProt: O60563