EEF2 antibody

Catalog No. ABIN7880744

This Mouse Monoclonal antibody specifically detects EEF2 in WB, IF, IHC (p) and FACS. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for EEF2 antibody (ABIN7880744)

Target: EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))

Reactivity: Human, Mouse, Rat

Host: Mouse

Clonality: Monoclonal

Conjugate: This EEF2 antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Clone: 5F5

Product Details anti-EEF2 Antibody

Purpose: EEF2 Antibody / Elongation factor 2

Sequence: QTETVLRQAI AERIKPVLMM NKMDRALLEL QLEPEELYQT FQR

Purification: Affinity purified

Immunogen: Amino acids QTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR from the human protein were used as the immunogen for the EEF2 antibody.

Isotype: IgG1

Application Details

Application Notes: Optimal dilution of the EEF2 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the EEF2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for EEF2

Target: EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))

Alternative Name: EEF2

Background: Eukaryotic elongation factor 2 is a protein that in humans is encoded by the EEF2 gene. This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.

UniProt: P13639

Pathways: AMPK Signaling