Fibrinogen beta Chain antibody

Catalog No. ABIN7880786

This Mouse Monoclonal antibody specifically detects Fibrinogen beta Chain in WB and IHC (p). It exhibits reactivity toward Human.

Quick Overview for Fibrinogen beta Chain antibody (ABIN7880786)

Target: Fibrinogen beta Chain (FGB)

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This Fibrinogen beta Chain antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 6D12

Product Details anti-Fibrinogen beta Chain Antibody

Purpose: FGB Antibody / Fibrinogen beta chain

Sequence: TNLRVLRSIL ENLRSKIQKL ESDVSAQMEY CRT

Purification: Affinity purified

Immunogen: Amino acids TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT from the human protein were used as the immunogen for the FGB antibody.

Isotype: IgG2b

Application Details

Application Notes: Optimal dilution of the FGB antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the FGB antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for Fibrinogen beta Chain

Target: Fibrinogen beta Chain (FGB)

Alternative Name: FGB

Background: Fibrinogen beta chain, mapped to 4q31.3, is also known as FGB. The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

UniProt: P02675