MLX antibody

Catalog No. ABIN7881563

The Rabbit Polyclonal anti-MLX antibody (ABIN7881563) specifically detects MLX in WB and FACS. The antibody is reactive with Human, Mouse and Monkey samples.

Quick Overview for MLX antibody (ABIN7881563)

Target: MLX (MAX-Like Protein X (MLX))

Reactivity: Human, Mouse, Monkey

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MLX antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS)

Product Details anti-MLX Antibody

Purpose: MLX Antibody / Max-like protein X

Sequence: FQELSACVFS WIEEHCKPQT LREIVIGVLH QLKNQLY

Purification: Antigen affinity purified

Immunogen: Amino acids FQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY from the human protein were used as the immunogen for the MLX antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the MLX antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the MLX antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for MLX

Target: MLX (MAX-Like Protein X (MLX))

Alternative Name: MLX

Background: Max-like protein X is a protein that in humans is encoded by the MLX gene. The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

UniProt: Q9UH92