CCDC90A antibody

Catalog No. ABIN7881645

This Rabbit Polyclonal antibody specifically detects CCDC90A in WB and IHC (p). It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for CCDC90A antibody (ABIN7881645)

Target: CCDC90A (MCUR1) (Mitochondrial Calcium Uniporter Regulator 1 (MCUR1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC90A antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-CCDC90A Antibody

Purpose: MCUR1 Antibody / Mitochondrial calcium uniporter regulator 1

Sequence: ATQQAEIIVS ALVKILEANM DIVYKDMVTK MQQE

Purification: Antigen affinity purified

Immunogen: Amino acids ATQQAEIIVSALVKILEANMDIVYKDMVTKMQQE from the human protein were used as the immunogen for the MCUR1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the MCUR1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the MCUR1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for CCDC90A

Target: CCDC90A (MCUR1) (Mitochondrial Calcium Uniporter Regulator 1 (MCUR1))

Alternative Name: MCUR1

Background: MCUR1 is an inner mitochondrial membrane protein that has been shown to function as a component of the mitochondrial Ca(2+) uniporter, in the assembly of mitochondrial respiratory complex IV, and in mitochondrial permeability transition (MPT). The MCUR1 gene is mapped to chromosome 6p23 based on an alignment of the MCUR1 sequence with the genomic sequence.

UniProt: Q96AQ8