NFIB antibody

Catalog No. ABIN7881837

This Mouse Monoclonal antibody specifically detects NFIB in WB, IF and FACS. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for NFIB antibody (ABIN7881837)

Target: NFIB (Nuclear Factor I/B (NFIB))

Reactivity: Human, Mouse, Rat

Host: Mouse

Clonality: Monoclonal

Conjugate: This NFIB antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS)

Clone: 4D6E4

Product Details anti-NFIB Antibody

Purpose: Nuclear factor 1 B-type Antibody / NFIB

Sequence: ELVRVS

Purification: Antigen affinity purified

Immunogen: Amino acids ELVRVS RTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR from the human protein were used as the immunogen for the Nuclear factor 1 B-type antibody.

Isotype: IgG2b

Application Details

Application Notes: Optimal dilution of the Nuclear factor 1 B-type antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the Nuclear factor 1 B-type antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for NFIB

Target: NFIB (Nuclear Factor I/B (NFIB))

Alternative Name: Nuclear factor 1 B-type

Background: Nuclear factor 1 B-type is a protein that in humans is encoded by the NFIB gene. The NFIB gene is a part of the NFI gene complex that includes three other genes (NFIA, NFIC and NFIX). The NFIB gene is a protein coding gene that also serves as a transcription factor. This gene is essential in embryonic development and it works together with its gene complex to initiate tissue differentiation in the fetus. Through knockout experiments, researchers found that mice without the NFIB gene have severely underdeveloped lungs. This mutation does not seem to cause spontaneous abortions because in utero the fetus does not use its lungs for respiration. However, this becomes lethal once the fetus is born and has to take its first breath. It is thought that NFIB plays a role in down regulating the transcription factors TGF-?1 and Shh in normal gestation because they remained high in knockout experiments. The absence of NFIB also leads to insufficient amounts of surfactant being produced which is one reason why the mice cannot breathe once it is born. The knockout experiments demonstrated that NFIB has a significant role in fore-brain development. NFIB is typically found in pontine nuclei of the CNS, the cerebral cortex and the white matter of the brain and without NFIB these areas are dramatically affected.

UniProt: O00712