PITX2 antibody

Catalog No. ABIN7881897

This Rabbit Polyclonal antibody specifically detects PITX2 in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for PITX2 antibody (ABIN7881897)

Target: PITX2 (Paired-Like Homeodomain 2 (PITX2))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PITX2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PITX2 Antibody

Purpose: PITX2 Antibody

Sequence: METNCRKLVS ACVQLGVQPA AVECLFSKDS EIKK

Purification: Affinity purified

Immunogen: Amino acids METNCRKLVSACVQLGVQPAAVECLFSKDSEIKK were used as the immunogen for the PITX2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the PITX2 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the PITX2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for PITX2

Target: PITX2 (Paired-Like Homeodomain 2 (PITX2))

Alternative Name: PITX2

Background: Paired-like homeodomain transcription factor 2 also known as pituitary homeobox 2 is a protein that in humans is encoded by the PITX2 gene. It is mapped to 4q25. This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. The encoded protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. This protein plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this gene are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly. A similar protein in other vertebrates is involved in the determination of left-right asymmetry during development. Alternatively spliced transcript variants encoding distinct isoforms have been described.

UniProt: Q99697

Pathways: Retinoic Acid Receptor Signaling Pathway, Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development