Vinexin antibody

Catalog No. ABIN7882336

The Rabbit Polyclonal anti-Vinexin antibody is suitable to detect Vinexin in samples from Human, Mouse and Rat. It has been validated for WB, IHC (p), IF and FACS.

Quick Overview for Vinexin antibody (ABIN7882336)

Target: Vinexin (Sorbs3) (Sorbin and SH3 Domain Containing 3 (Sorbs3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Vinexin antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF), Flow Cytometry (FACS)

Product Details anti-Vinexin Antibody

Purpose: Vinexin Antibody / SORBS3

Sequence: ASTKIPASQH TQNWSATWTK DSKRRDKRWV KYE

Purification: Affinity purified

Immunogen: Amino acids ASTKIPASQHTQNWSATWTKDSKRRDKRWVKYE from the human protein were used as the immunogen for the Vinexin antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Vinexin antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the Vinexin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for Vinexin

Target: Vinexin (Sorbs3) (Sorbin and SH3 Domain Containing 3 (Sorbs3))

Alternative Name: Vinexin

Background: Vinexin is a protein that in humans is encoded by the SORBS3 gene. It is mapped to 8p21.3. This gene encodes an SH3 domain-containing adaptor protein. The presence of SH3 domains play a role in this protein's ability to bind other cytoplasmic molecules and contribute to cystoskeletal organization, cell adhesion and migration, signaling, and gene expression. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: O60504

Pathways: MAPK Signaling