SYNPO antibody

Catalog No. ABIN7882410

This Rabbit Polyclonal antibody specifically detects SYNPO in WB, IF, IHC (p) and FACS. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for SYNPO antibody (ABIN7882410)

Target: SYNPO (Synaptopodin (SYNPO))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SYNPO antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Product Details anti-SYNPO Antibody

Purpose: SYNPO Antibody / Synaptopodin

Sequence: EKPKVTPNPD LLDLVQTADE KRRQRDHGEV GMEEE

Purification: Affinity purified

Immunogen: Amino acids EKPKVTPNPDLLDLVQTADEKRRQRDHGEVGMEEE from the human protein were used as the immunogen for the SYNPO antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the SYNPO antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the SYNPO antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for SYNPO

Target: SYNPO (Synaptopodin (SYNPO))

Alternative Name: SYNPO

Background: The spine apparatus (SA) is a specialized form of endoplasmic reticulum (ER) that is found in a subpopulation of dendritic spines in central neurons. The SA consists of a series of stacked discs that are though to be connected to each other and to the dendritic system of ER-tubules. The actin binding protein synaptopodin (which has originally been described in podocytes of the kidney) is an essential component of the SA. Mice that lack the gene for synaptopodin do not form a spine apparatus. The SA is believed to play a critical role in learning and memory. In summary, an important function of the spine apparatus is the regulation of plasticity at individual synapses, a process known as metaplasticity. The International Radiation Hybrid Mapping Consortium mapped the SYNPO gene to chromosome 5.

UniProt: Q8N3V7