RENT1/UPF1 antibody

Catalog No. ABIN7882643

The Mouse Monoclonal anti-RENT1/UPF1 antibody (Clone 11E7-) (ABIN7882643) specifically detects RENT1/UPF1 in WB, IF and IHC (p). The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for RENT1/UPF1 antibody (ABIN7882643)

Target: RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))

Reactivity: Human, Mouse, Rat

Host: Mouse

Clonality: Monoclonal

Conjugate: This RENT1/UPF1 antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 11E7-

Product Details anti-RENT1/UPF1 Antibody

Purpose: RENT1 Antibody / hUPF1

Sequence: NMDSMPELQK LQQLKDETGE LSSADEKRYR ALKRT

Purification: Affinity purified

Immunogen: Amino acids NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE from the human protein were used as the immunogen for the RENT1 antibody.

Isotype: IgG2b

Application Details

Application Notes: Optimal dilution of the RENT1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the RENT1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for RENT1/UPF1

Target: RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))

Alternative Name: RENT1

Background: Regulator of nonsense transcripts 1 is a protein that in humans is encoded by the UPF1 gene. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. And this protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. Alternative splicing results in multiple transcript variants.

UniProt: Q92900

Pathways: SARS-CoV-2 Protein Interactome