YY1 antibody

Catalog No. ABIN7882717

The Mouse Monoclonal anti-YY1 antibody is suitable to detect YY1 in samples from Human, Mouse and Rat. It has been validated for WB, IHC (p) and FACS.

Quick Overview for YY1 antibody (ABIN7882717)

Target: YY1 (YY1 Transcription Factor (YY1))

Reactivity: Human, Mouse, Rat

Host: Mouse

Clonality: Monoclonal

Conjugate: This YY1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Clone: 2C10F9

Product Details anti-YY1 Antibody

Purpose: YY1 Antibody / Yin and Yang 1

Sequence: EQKQVQIKTL EGEFSVTMWS SDEKKDIDHE TVVEEQ

Purification: Antigen affinity purified

Immunogen: Amino acids EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ were used as the immunogen for the YY1 antibody.

Isotype: IgG2a

Application Details

Application Notes: Optimal dilution of the YY1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the YY1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for YY1

Target: YY1 (YY1 Transcription Factor (YY1))

Alternative Name: YY1

Background: YY1 (Yin Yang 1) is a transcriptional repressor protein in humans that is encoded by the YY1 gene. YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.

UniProt: P25490