ZEB1 antibody

Catalog No. ABIN7882724

The Rabbit Polyclonal anti-ZEB1 antibody (ABIN7882724) specifically detects ZEB1 in WB, IF, FACS and IHC (p). The antibody is reactive with Human samples.

Quick Overview for ZEB1 antibody (ABIN7882724)

Target: ZEB1 (Zinc Finger E-Box Binding Homeobox 1 (ZEB1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZEB1 antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-ZEB1 Antibody

Purpose: ZEB1 Antibody

Sequence: LLKAYYALNA QPSAEELSKI ADSVNLPLDV VKKWFEKMQ

Purification: Affinity purified

Immunogen: Amino acids LLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQ were used as the immunogen for the ZEB1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the ZEB1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the ZEB1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for ZEB1

Target: ZEB1 (Zinc Finger E-Box Binding Homeobox 1 (ZEB1))

Alternative Name: ZEB1

Background: Zinc finger E-box-binding homeobox 1 is a protein that in humans is encoded by the ZEB1 gene. It is mapped to 10p11.22. This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described.

UniProt: P37275

Pathways: Regulation of Muscle Cell Differentiation