GLI3 antibody

Catalog No. ABIN8101492

This Rabbit Polyclonal antibody specifically detects GLI3 in IHC. It exhibits reactivity toward Human, Mouse, Rat, Dog, Rabbit, Cow, Horse, Guinea Pig and Zebrafish (Danio rerio).

Quick Overview for GLI3 antibody (ABIN8101492)

Target: GLI3 (GLI Family Zinc Finger 3 (GLI3))

Reactivity: Human, Mouse, Rat, Dog, Rabbit, Cow, Horse, Guinea Pig, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLI3 antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-GLI3 Antibody

Purpose: GLI3 Antibody

Sequence: KPDEDLPSPG ARGQQEQPEG TTLVKEEGDK DESKQEPEVI YETNCHWEGC

Predicted Reactivity: Cow: 100%, Dog: 93%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 100%, Rabbit: 100%, Rat: 100%, Zebrafish: 79%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence KPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYETNCHWEGC

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP32317-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for GLI3

Target: GLI3 (GLI Family Zinc Finger 3 (GLI3))

Alternative Name: GLI3

Background:

Background Information: This gene encodes a protein which belongs to the C2H2-type zinc finger proteins subclass of the Gli family. They are characterized as DNA-binding transcription factors and are mediators of Sonic hedgehog (Shh) signaling. The protein encoded by this gene localizes in the cytoplasm and activates patched Drosophila homolog (PTCH) gene expression. It is also thought to play a role during embryogenesis. Mutations in this gene have been associated with several diseases, including Greig cephalopolysyndactyly syndrome, Pallister-Hall syndrome, preaxial polydactyly type IV, and postaxial polydactyly types A1 and B.

Gene Name: GLI family zinc finger 3

Alternative Symbols: PHS, ACLS, GCPS, PAPA, PAPB, PAP-A, PAPA1, PPDIV, GLI3FL, GLI3-190

Protein Name: Transcriptional activator GLI3

Molecular Weight: 170 kDa

Gene ID: 2737

NCBI Accession: NP_000159

UniProt: P10071

Pathways: Hedgehog Signaling