RICTOR antibody

Catalog No. ABIN8111026

This Rabbit Polyclonal antibody specifically detects RICTOR in IHC. It exhibits reactivity toward Human, Mouse, Rat, Dog, Horse, Rabbit, Pig and Cow.

Quick Overview for RICTOR antibody (ABIN8111026)

Target: RICTOR (RPTOR Independent Companion of mTOR, Complex 2 (RICTOR))

Reactivity: Human, Mouse, Rat, Dog, Horse, Rabbit, Pig, Cow

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RICTOR antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-RICTOR Antibody

Purpose: RICTOR Antibody

Sequence: GENDLKFTKN FGTENHRENT SRERLVVESS TSSHMKIRSQ SFNTDTTTSG

Predicted Reactivity: Cow: 93%, Dog: 100%, Horse: 100%, Human: 100%, Mouse: 93%, Pig: 93%, Rabbit: 100%, Rat: 100%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GENDLKFTKNFGTENHRENTSRERLVVESSTSSHMKIRSQSFNTDTTTSG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP61411-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for RICTOR

Target: RICTOR (RPTOR Independent Companion of mTOR, Complex 2 (RICTOR))

Alternative Name: RICTOR

Background:

Background Information: RICTOR and MTOR (FRAP1, MIM 601231) are components of a protein complex that integrates nutrient- and growth factor-derived signals to regulate cell growth (Sarbassov et al., 2004 [PubMed 15268862]).[supplied by OMIM, Mar 2008]

Gene Name: RPTOR independent companion of MTOR, complex 2

Alternative Symbols: PIA, AVO3, hAVO3

Protein Name: Rapamycin-insensitive companion of mTOR

Molecular Weight: 192 kDa

Gene ID: 253260

NCBI Accession: NP_689969

UniProt: Q6R327

Pathways: Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Actin Filament Polymerization, CXCR4-mediated Signaling Events