NEU2 antibody

Catalog No. ABIN8111686

This Rabbit Polyclonal antibody specifically detects NEU2 in IHC. It exhibits reactivity toward Human, Rat, Mouse, Dog, Pig, Cow, Guinea Pig and Rabbit.

Quick Overview for NEU2 antibody (ABIN8111686)

Target: NEU2 (Sialidase 2 (Cytosolic Sialidase) (NEU2))

Reactivity: Human, Rat, Mouse, Dog, Pig, Cow, Guinea Pig, Rabbit

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NEU2 antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-NEU2 Antibody

Purpose: NEU2 Antibody

Sequence: SGAHAYRIPA LLYLPGQQSL LAFAEQRASK KDEHAELIVL RRGDYDAPTH

Predicted Reactivity: Cow: 79%, Dog: 86%, Guinea Pig: 85%, Human: 100%, Mouse: 86%, Pig: 86%, Rabbit: 77%, Rat: 79%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence SGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTH

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP64280-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for NEU2

Target: NEU2 (Sialidase 2 (Cytosolic Sialidase) (NEU2))

Alternative Name: NEU2

Background:

Background Information: This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments.

Gene Name: sialidase 2 (cytosolic sialidase)

Alternative Symbols: SIAL2

Protein Name: Sialidase-2

Molecular Weight: 42 kDa

Gene ID: 4759

NCBI Accession: NP_005374

UniProt: Q9Y3R4

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development