Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

SYCE1 antibody (Synaptonemal Complex Central Element Protein 1) (AA 1-190) Primary Antibody

SYCE1 Reactivity: Human ELISA, WB Host: Mouse Monoclonal 6G7
Catalog No. ABIN949790
$440.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Binding Specificity
    AA 1-190
    Reactivity
    Human
    Host
    Mouse
    Clonality
    Monoclonal
    Application
    ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a full-length recombinant SYCE1.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: SYCE1 (NP_963858.1, 1 a.a. ~ 190 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: MLQECKERISALNLQIEEEKNKQRQLRLAFEEQLEDLMGQHKDLWDFHMPERLAKEICALDSSKEQLLKEEKLVKATLEDVKHQLCSLCGAEGPSTLDEGLFLRSQEAAATVQLFQEEHRKAEELLAAAAQRHQQLQQKCQQQQQKRQRLKEELEKHGMQVPAQAQSTQEEEAGPGDVAPRPGRPVTWWS

    Clone
    6G7
    Isotype
    IgG2a kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    Alternative Name
    SYCE1 (SYCE1 Antibody Abstract)
    Synonyms
    C10orf94, CT76, 4933406J07Rik, synaptonemal complex central element protein 1, SYCE1, Syce1
    Background
    Full Gene Name: synaptonemal complex central element protein 1
    Synonyms: C10orf94,RP11-108K14.6,bA108K14.6
    Gene ID
    93426
    NCBI Accession
    NP_963858, NM_201564
    Pathways
    M Phase
You are here: