anti-Human Kallikrein 6 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Kallikrein 6 Antibody (supplied by: Log in to see )

Kallikrein 6 (KLK6) Antibodies
  • klk6
  • KLK8
  • Klk1b21
  • Klk6
  • rGK-8
  • rk8
  • AI849898
  • BSP
  • Bssp
  • Klk29
  • MSP
  • Prss18
  • Prss9
  • neurosin
  • Klk7
  • PRSS18
  • PRSS9
  • SP59
  • hK6
  • kallikrein 1
  • kallikrein 1-related peptidase C8
  • kallikrein related-peptidase 6
  • kallikrein related peptidase 6
  • kallikrein-6
  • klk1
  • Klk1c8
  • Klk6
  • KLK6
  • LOC100716801
This Kallikrein 6 antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4890310
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN652195 FACS IHC (p) WB Rabbit Ig Fraction AA 1-30, N-Term Log in to see Polyclonal 3
1 ABIN652196 FACS IHC (p) WB Rabbit Ig Fraction AA 126-156, Center Log in to see Polyclonal 3
1 ABIN3044157 ICC IHC (p) WB Rabbit IgG AA 227-244, C-Term Log in to see Polyclonal
1 ABIN759101 IF (p) IHC (p) WB Rabbit IgG AA 200-240 Log in to see Polyclonal
1 ABIN768743 IHC (p) WB Rabbit IgG AA 74-123 Log in to see Polyclonal
1 ABIN1908534 IHC (p) ELISA Goat AA 145-156 Log in to see Polyclonal
1 ABIN759110 IHC (p) WB HRP Rabbit IgG AA 200-240 Log in to see Polyclonal
1 ABIN759103 IHC (p) WB Biotin Rabbit IgG AA 200-240 Log in to see Polyclonal
1 ABIN2624595 ICC IHC (p) WB Rabbit IgG AA 227-244 Log in to see Polyclonal
1 ABIN5531502 FACS IHC (p) WB Rabbit Ig Fraction AA 126-156 Log in to see Polyclonal
1 ABIN3031530 ICC IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN2963231 IHC (p) ELISA Goat AA 145-156, Internal Region Log in to see Polyclonal
1 ABIN2140349 IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal


Antigen Kallikrein 6 (KLK6) Antibodies
Epitope N-Term
(17), (15), (9), (6), (5), (5), (5), (4), (4), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity Human
(69), (29), (28), (4), (2), (1), (1)
Host Rabbit
(66), (22), (10)
Conjugate This Kallikrein 6 antibody is un-conjugated
(7), (5), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(70), (47), (20), (13), (13), (8), (7), (3), (3), (2), (2), (2), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-Kallikrein 6 Antibody

Target Details Kallikrein 6 Application Details Handling Images
Purification Immunogen affinity purified
Immunogen Synthetic peptides corresponding to KLK6(kallikrein-related peptidase 6) The peptide sequence was selected from the N terminal of KLK6. Peptide sequence KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ.

Target Details Kallikrein 6

Product Details anti-Kallikrein 6 Antibody Application Details Handling Images back to top
Alternative Name Kallikrein 6/Neurosin (KLK6 Antibody Abstract)
Background Gene Symbol: KLK6
Molecular Weight Theoretical MW: 25 kDa
Gene ID 5653
UniProt Q92876
Pathways Complement System, Regulation of G-Protein Coupled Receptor Protein Signaling

Application Details

Product Details anti-Kallikrein 6 Antibody Target Details Kallikrein 6 Handling Images back to top
Application Notes Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500This is a rabbit polyclonal antibody against KLK6 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-Kallikrein 6 Antibody Target Details Kallikrein 6 Application Details Images back to top
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.


Product Details anti-Kallikrein 6 Antibody Target Details Kallikrein 6 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Kallikrein 6 (KLK6) (N-Term) antibody (ABIN4890310) Western Blot: Kallikrein 6/Neurosin Antibody [NBP1-54713] - 721_B cell lysate, Antibo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Kallikrein 6 (KLK6) (N-Term) antibody (ABIN4890310) Immunohistochemistry-Paraffin: Kallikrein 6/Neurosin Antibody [NBP1-54713] - Human Lu...
Western Blotting (WB) image for anti-Kallikrein 6 (KLK6) (N-Term) antibody (ABIN4890310) Western Blot: Kallikrein 6/Neurosin Antibody [NBP1-54713] - Jurkat Whole Cell lysates...