Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182493

Myogenic Factor 5 (MYF5) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms bHLHc2, Myf-5, B130010J22Rik, myf-5, Xmyf5, xmyf-5, cb641, zgc:110509, Xmyf-5, MYF5
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182493
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MYF5 antibody: synthetic peptide directed towards the N terminal of human MYF5
Sequence ACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCT TTNPNQRLPK
Predicted Reactivity Bovine : 100%, Chicken : 100%, Goat : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Sheep : 100%, Dog : 93%, African clawed frog : 86%, Zebrafish : 80%
Characteristics This is a rabbit polyclonal antibody against MYF5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MYF5
Background MYF5 is a member of the myogenic basic helix-loop-helix family of transcription factors, which can activate the muscle differentiation program.
Molecular Weight 28kDa
Gene ID 4617
NCBI Accession NP_005584, NM_005593
UniProt P13349
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MYF5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Roy, de la Serna, Imbalzano: "The myogenic basic helix-loop-helix family of transcription factors shows similar requirements for SWI/SNF chromatin remodeling enzymes during muscle differentiation in culture." in: The Journal of biological chemistry, Vol. 277, Issue 37, pp. 33818-24, 2002 (PubMed).

Alternatives for antigen "Myogenic Factor 5 (MYF5)", type "Antibodies"
Hosts (58), (7)
Reactivities (62), (46), (15), (13), (13), (12), (1), (1)
Applications (44), (33), (20), (10), (7), (4), (2)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (17), (10), (5), (3), (2), (2), (2), (1), (1)
Beacon