Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182555

Sirtuin 1 (SIRT1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SIR2L1, SIR2, sir2l1, sirtuin, AA673258, Sir2, Sir2a, Sir2alpha, sirtuin 1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN182555
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SIRT1 antibody: synthetic peptide directed towards the N terminal of human SIRT1
Sequence PETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDA VKLLQECKKI
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, African clawed frog : 92%, Chicken : 85%, Zebrafish : 84%
Characteristics This is a rabbit polyclonal antibody against SIRT1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name SIRT1
Background SIRT1 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined, however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family.
Molecular Weight 82kDa
Gene ID 23411
NCBI Accession NP_036370, NM_012238
UniProt Q96EB6
Research Area Chromatin and Nuclear Signaling, Apoptosis/Necrosis, Proteases
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SIRT1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Anavekar, Mirza, Skali et al.: "Risk assessment in patients with depressed left ventricular function after myocardial infarction using the myocardial performance index--Survival and Ventricular Enlargement (SAVE) experience." in: Journal of the American Society of Echocardiography : official publication of the American Society of Echocardiography, Vol. 19, Issue 1, pp. 28-33, 2006 (PubMed).

Background publications Solomon, Pasupuleti, Xu et al.: "Inhibition of SIRT1 catalytic activity increases p53 acetylation but does not alter cell survival following DNA damage." in: Molecular and cellular biology, Vol. 26, Issue 1, pp. 28-38, 2005 (PubMed).

Alternatives for antigen "Sirtuin 1 (SIRT1)", type "Antibodies"
Hosts (114), (21), (9), (7)
Reactivities (142), (82), (39), (26), (25), (14), (13), (5), (1), (1)
Applications (111), (71), (40), (32), (31), (24), (14), (11), (6), (4), (2), (1), (1), (1)
Conjugates (10), (7), (5), (4), (4), (4), (4), (4), (4), (4), (4), (1), (1), (1)
Epitopes (18), (15), (13), (10), (10), (5), (5), (2), (2), (1), (1), (1), (1)
Beacon