Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182697

Aprataxin (APTX) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AOA, AOA1, AXA1, EAOH, EOAHA, FHA-HIT, AA388047, 2410016G21Rik, aptx, APTX, LOC100284636, APRATAXIN-like, T10O8.20, T10O8_20
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Pig (Porcine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182697
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-APTX antibody: synthetic peptide directed towards the N terminal of human APTX
Sequence MMRVCWLVRQDSRHQRIRLPHLEAVVIGRGPETKITDKKC SRQQVQLKAE
Predicted Reactivity Human : 100%, Horse : 92%, Mouse : 92%, Rat : 92%, African clawed frog : 85%, Guinea pig : 85%, Pig : 85%, Dog : 84%
Characteristics This is a rabbit polyclonal antibody against APTX. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name APTX
Background APTX is a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. APTX may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia.This gene encodes a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. The encoded protein may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia. Multiple transcript variants encoding distinct isoforms have been identified for this gene, however, the full length nature of some variants has not been determined.
Molecular Weight 38kDa
Gene ID 54840
NCBI Accession NP_778243, NM_175073
UniProt Q6JV85
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-APTX antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ahnesorg, Smith, Jackson: "XLF interacts with the XRCC4-DNA ligase IV complex to promote DNA nonhomologous end-joining." in: Cell, Vol. 124, Issue 2, pp. 301-13, 2006 (PubMed).

Alternatives for antigen "Aprataxin (APTX)", type "Antibodies"
Hosts (23), (3), (1)
Reactivities (27), (14), (13), (13), (2), (2), (1), (1)
Applications (17), (10), (6), (4), (3), (2), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (1), (1), (1), (1), (1), (1)
Beacon