Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183187

Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GRIK5, EAA4, GLR6, GLUK6, GLUR6, GluK2, MRT6, AW124492, Glur-6, Glur6, Glurbeta2, GluR6, eaa4, glr6, gluk6, grik2-A, mrt6, GRIK2, glur6, grik2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183187
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GRIK2 antibody: synthetic peptide directed towards the N terminal of human GRIK2
Sequence PDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIK APSRYNLRLK
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against GRIK2. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name GRIK2
Background The GRIK2 gene encodes a subunit of a kainate glutamate receptor. Glutamate receptors mediate the majority of excitatory neurotransmission in the brain. This receptor may have a role in synaptic plasticity and may be important for learning and memory. It also may be involved in the transmission of light information from the retina to the hypothalamus. The structure and function of the encoded protein is changed by RNA editing.
Molecular Weight 40kDa
Gene ID 2898
UniProt Q8IY40
Research Area Neurology, Signaling, Amino Acids
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GRIK2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Delorme, Krebs, Chabane et al.: "Frequency and transmission of glutamate receptors GRIK2 and GRIK3 polymorphisms in patients with obsessive compulsive disorder." in: Neuroreport, Vol. 15, Issue 4, pp. 699-702, 2004 (PubMed).

Alternatives for antigen "Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2)", type "Antibodies"
Hosts (59), (1)
Reactivities (56), (35), (35), (20), (20), (18), (4), (4), (2), (1), (1), (1), (1)
Applications (46), (21), (15), (10), (10), (9), (5), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (14), (6), (2), (1), (1), (1)
Beacon