Did you know that you can buy products from over 140 different suppliers from us?

Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2) (N-Term) antibody

Details for Product No. ABIN183187
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GRIK5, eaa4, glr6, gluk6, glur6, grik2, mrt6, GluR6, grik2-A, EAA4, GLR6, GLUK6, GLUR6, GluK2, MRT6, AW124492, Glur-6, Glur6, Glurbeta2, GRIK2
Epitope
N-Term
(24), (7), (6), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Human
(66), (35), (35), (19), (19), (17), (3), (3), (2), (1)
Host
Rabbit
(69), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(52), (23), (15), (14), (14), (11), (5), (1), (1), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183187
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human GRIK2
Sequence PDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIK APSRYNLRLK
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against GRIK2. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name GRIK2
Background The GRIK2 gene encodes a subunit of a kainate glutamate receptor. Glutamate receptors mediate the majority of excitatory neurotransmission in the brain. This receptor may have a role in synaptic plasticity and may be important for learning and memory. It also may be involved in the transmission of light information from the retina to the hypothalamus. The structure and function of the encoded protein is changed by RNA editing.
Molecular Weight 102 kDa
Gene ID 2898
UniProt Q8IY40
Research Area Neurology, Signaling, Amino Acids
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 908 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2) (N-Term) antibody WB Suggested Anti-GRIK2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
anti-Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2) (N-Term) antibody (2) anti-Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2) (N-Term) antibody (Image 2)
anti-Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2) (N-Term) antibody (3) WB Suggested Anti-GRIK2
Antibody Titration: 1.25 µg/mL ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
Product cited in: Delorme, Krebs, Chabane et al.: "Frequency and transmission of glutamate receptors GRIK2 and GRIK3 polymorphisms in patients with obsessive compulsive disorder." in: Neuroreport, Vol. 15, Issue 4, pp. 699-702, 2004 (PubMed).

Validation Images
back to top