Did you know that you can buy products from over 140 different suppliers from us?

DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 5 (DDX5) (N-Term) antibody

Details for Product No. ABIN183332
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms wu:fa56a07, wu:fb11e01, wu:fb16c10, wu:fb53b05, G17P1, HLR1, HUMP68, p68, 2600009A06Rik, Hlr1
Epitope
N-Term
(18), (17), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
(75), (43), (42), (25), (13), (4)
Host
Rabbit
(61), (10), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(45), (27), (20), (18), (17), (16), (7), (6), (2), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183332
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human DDX5
Sequence RGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLD ELPKFEKNFY
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Rabbit : 100 %, Mouse : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against DDX5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name DDX5
Background DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX5 encodes a DEAD box protein, which is a RNA-dependent ATPase, and also a proliferation-associated nuclear antigen, specifically reacting with the simian virus 40 tumor antigen. DDX5 consists of 13 exons, and alternatively spliced transcripts containing several intron sequences have been detected, but no isoforms encoded by these transcripts have been identified.
Molecular Weight 68 kDa
Gene ID 1655
NCBI Accession NM_004396, NP_004387
UniProt P17844
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 614 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 5 (DDX5) (N-Term) antibody WB Suggested Anti-DDX5 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Guil, Gattoni, Carrascal et al.: "Roles of hnRNP A1, SR proteins, and p68 helicase in c-H-ras alternative splicing regulation." in: Molecular and cellular biology, Vol. 23, Issue 8, pp. 2927-41, 2003 (PubMed).

Validation Images
back to top