Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183475

PYD and CARD Domain Containing (PYCARD) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ASC, CARD5, TMS, TMS-1, TMS1, Asc
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus)
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183475
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PYCARD antibody: synthetic peptide directed towards the middle region of mouse PYCARD
Sequence TVLRDMGLQELAEQLQTTKEESGAVAAAASVPAQSTARTG HFVDQHRQAL
Predicted Reactivity Mouse : 100%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against PYCARD. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name PYCARD
Background Pycard is a cytosolic soluble protein that forms insoluble aggregates and enhances etoposide-induced apoptosis.
Molecular Weight 21kDa
Gene ID 66824
NCBI Accession NP_075747, NM_023258
UniProt Q9EPB4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PYCARD antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Mariathasan, Newton, Monack et al.: "Differential activation of the inflammasome by caspase-1 adaptors ASC and Ipaf." in: Nature, Vol. 430, Issue 6996, pp. 213-8, 2004 (PubMed).

Alternatives for antigen "PYD and CARD Domain Containing (PYCARD)", type "Antibodies"
Hosts (53), (14), (8)
Reactivities (70), (23), (18), (12), (12), (12), (8), (1)
Applications (63), (23), (20), (10), (8), (7), (7), (7), (3), (3), (2), (2), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (13), (5), (5), (4), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon