Did you know that you can buy products from over 140 different suppliers from us?

PYD and CARD Domain Containing (PYCARD) (Middle Region) antibody

Details for Product No. ABIN183475
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ASC, CARD5, TMS, TMS-1, TMS1, 9130417A21Rik, Asc, TNS1, masc, asc1, zAsc, zgc:109874
Epitope
Middle Region
(16), (5), (5), (5), (3), (3), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus)
(63), (20), (17), (12), (12), (12), (8), (1)
Host
Rabbit
(48), (13), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(56), (22), (17), (11), (10), (9), (7), (5), (3), (3), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183475
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of mouse PYCARD
Sequence TVLRDMGLQELAEQLQTTKEESGAVAAAASVPAQSTARTG HFVDQHRQAL
Predicted Reactivity Mouse : 100 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against PYCARD. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name PYCARD
Background Pycard is a cytosolic soluble protein that forms insoluble aggregates and enhances etoposide-induced apoptosis.
Molecular Weight 21 kDa
Gene ID 66824
NCBI Accession NM_023258, NP_075747
UniProt Q9EPB4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 193 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Mariathasan, Newton, Monack et al.: "Differential activation of the inflammasome by caspase-1 adaptors ASC and Ipaf." in: Nature, Vol. 430, Issue 6996, pp. 213-8, 2004 (PubMed).

Validation Images
back to top