Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183579

Transforming Growth Factor, beta 1 (TGFB1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
CED, LAP, DPD1, TGFB, TGFbeta, TGF-beta, Tgfb, Tgfb-1, TGFbeta1, TGF-beta1, TGF-BETA-1, TGF-beta5, ced, dpd1, lap, tgf-beta, tgfb, tgfb5, tgfbeta, ai39657, tgfb1, wu:fb13a07, xx:ai39657, TGFB1, TGFBI, ... show more
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine)
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183579
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TGFB1 antibody: synthetic peptide directed towards the middle region of mouse TGFB1
Sequence DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDN KLHVEINGIS
Predicted Reactivity Mouse : 100%, Rat : 93%, Pig : 92%, Guinea pig : 86%, Bovine : 78%, Dog : 78%, Horse : 78%, Sheep : 78%
Characteristics This is a rabbit polyclonal antibody against TGFB1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TGFB1
Background Tgfb1 is a multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of them have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone remodelling. It is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.
Molecular Weight 43kDa
Gene ID 21803
NCBI Accession NP_035707, NM_011577
UniProt P04202
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TGFB1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Cheon, Wei, Gurung et al.: "Beta-catenin regulates wound size and mediates the effect of TGF-beta in cutaneous healing." in: FASEB journal : official publication of the Federation of American Societies for Experimental Biology, Vol. 20, Issue 6, pp. 692-701, 2006 (PubMed).

Alternatives for antigen "Transforming Growth Factor, beta 1 (TGFB1)", type "Antibodies"
Hosts (139), (54), (3), (2), (1)
Reactivities (137), (47), (42), (23), (18), (14), (14), (12), (6), (6), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Applications (127), (111), (57), (55), (40), (29), (20), (17), (9), (7), (5), (4), (2), (2), (1), (1), (1)
Conjugates (17), (13), (5), (4), (4), (4), (4), (4), (4), (4), (4), (4), (1), (1)
Epitopes (12), (6), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon