Cyclin-Dependent Kinase 4 (CDK4) antibody

Antigen: Cyclin-Dependent Kinase 4 (CDK4)

Synonyms: CMM3, PSK-J3, MGC14458, 8-6, CDK4, CDK4/6, DmCdk4, Pk53C, Pk?7, l(2)05428, l(2)0671, l(2)k06503, l(2)s4639, l(2)sh0671, DmelCG5072, CG5072, MGC133903

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN184132

Additional Information

Alternative name: CDK4

Gene ID: CDK4

UniProt: P11802

Immunogen: The immunogen for anti-CDK4 antibody: synthetic peptide directed towards the C terminal of human CDK4

Sequence: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHS YLHKDEGNPE

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-CDK4 antibody concentration is 1 mg/ml.

Description: Cdk4 is probably involved in the control of the cell cycle.

Characteristics: Antigen Size: 303 amino acids

Molecular Weight: 34kDa

Application Details

Application Notes: WB Suggested Anti-CDK4 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Cell Cycle

Restrictions: For Research Use only

Images

WB Suggested Anti-CDK4 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Publications

Product: Elkahloun, Krizman, Wang et al.: "Transcript mapping in a 46-kb sequenced region at the core of 12q13.3 amplification in human cancers." in: Genomics, Vol. 42, Issue 2, pp. 295-301, 1997 (PubMed).