Cyclin-Dependent Kinase 1 (CDK1) (C-Term) antibody

Details for Product No. ABIN184166
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
CDC2, CDC28A, P34CDC2, Cdc2, Cdc2a, p34, cdc2, wu:fc30e01, zgc:92032, 5363, CDCDm, CDK1, CDK1/CDC2, CG5363, Cdk-1, Cdk1, Dcdc2, Dm cdc2, DmCdc2, DmCdk1, Dmcdc2, Dmel\\CG5363, cdc, cdc2Dm, cdk1,  ... show more
CDC2, CDC28A, P34CDC2, Cdc2, Cdc2a, p34, cdc2, wu:fc30e01, zgc:92032, 5363, CDCDm, CDK1, CDK1/CDC2, CG5363, Cdk-1, Cdk1, Dcdc2, Dm cdc2, DmCdc2, DmCdk1, Dmcdc2, Dmel\\CG5363, cdc, cdc2Dm, cdk1, dCdk1, group 4, l(2)31Eh, CDC2A, CDC2AAT, CDK2, CDKA1, CDKA;1, CYCLIN-DEPENDENT KINASE A;1, cell division control 2 show less
Epitope
C-Term
(52), (51), (38), (28), (17), (16), (12), (6), (4), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Human
(421), (248), (237), (43), (38), (27), (26), (26), (15), (7), (5), (4), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(342), (123)
Clonality
Polyclonal
Conjugate
Un-conjugated
(13), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(377), (157), (121), (86), (63), (63), (60), (39), (21), (11), (11), (9), (3), (1), (1), (1), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN184166
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human CDC2
Sequence SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYF NDLDNQIKKM
Predicted Reactivity Human
Characteristics This is a rabbit polyclonal antibody against CDC2. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name CDC2
Background The protein encoded by CDC2 is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control. The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control.
Molecular Weight 34 kDa
Gene ID 983
NCBI Accession NM_001786, NP_001777
UniProt P06493
Research Area Cell Cycle
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 297 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Cyclin-Dependent Kinase 1 (CDK1) (C-Term) antibody WB Suggested Anti-CDC2 Antibody Titration: 0.1ug/ml
Positive Control: Jurkat cell lysate
anti-Cyclin-Dependent Kinase 1 (CDK1) (C-Term) antibody (2) anti-Cyclin-Dependent Kinase 1 (CDK1) (C-Term) antibody (Image 2)
Background publications Krämer, Mailand, Lukas et al.: "Centrosome-associated Chk1 prevents premature activation of cyclin-B-Cdk1 kinase." in: Nature cell biology, Vol. 6, Issue 9, pp. 884-91, 2004 (PubMed).

Hosts (342), (123)
Reactivities (421), (248), (237), (43), (38), (27), (26), (26), (15), (7), (5), (4), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applications (377), (157), (121), (86), (63), (63), (60), (39), (21), (11), (11), (9), (3), (1), (1), (1), (1), (1), (1)
Conjugates (13), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (1), (1)
Epitopes (52), (51), (38), (28), (17), (16), (12), (6), (4), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top