Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184166

Cyclin-Dependent Kinase 1 (CDK1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
CDC2, CDC28A, P34CDC2, Cdc2, Cdc2a, p34, cdc2, wu:fc30e01, zgc:92032, 5363, CDCDm, CDK1, CDK1/CDC2, CG5363, Cdk-1, Cdk1, Dcdc2, Dm cdc2, DmCdc2, DmCdk1, Dmcdc2, Dmel\\CG5363, cdc, cdc2Dm, cdk1,  ... show more
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN184166
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2
Sequence SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYF NDLDNQIKKM
Characteristics This is a rabbit polyclonal antibody against CDC2. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name CDC2
Background The protein encoded by CDC2 is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control. The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control.
Molecular Weight 34kDa
Gene ID 983
NCBI Accession NP_001777, NM_001786
UniProt P06493
Research Area Cell Cycle
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CDC2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Krämer, Mailand, Lukas et al.: "Centrosome-associated Chk1 prevents premature activation of cyclin-B-Cdk1 kinase." in: Nature cell biology, Vol. 6, Issue 9, pp. 884-91, 2004 (PubMed).

Alternatives for antigen "Cyclin-Dependent Kinase 1 (CDK1)", type "Antibodies"
Hosts (337), (129)
Reactivities (420), (248), (236), (45), (38), (31), (27), (26), (14), (9), (7), (4), (4), (3), (3), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applications (376), (158), (129), (83), (73), (60), (53), (33), (15), (11), (11), (11), (7), (4), (3), (3), (1), (1), (1), (1)
Conjugates (13), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (1), (1)
Epitopes (50), (49), (44), (24), (17), (15), (10), (4), (4), (4), (4), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Beacon