Did you know that you can buy products from over 140 different suppliers from us?

Cyclin A2 (CCNA2) (C-Term) antibody

Details for Product No. ABIN184172
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ccn1, ccna, ccna1, CCN1, CCNA, AA408589, Ccn-1, Ccn1, Ccna, CycA2, Cyca, cb671, chunp6924, wu:fi36f03, CYCA, Cyclin-A2, ccna2, Cyclin-A, cyclinA
Epitope
C-Term
(17), (13), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
(114), (47), (34), (24), (4), (4), (1)
Host
Rabbit
(85), (54), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(111), (46), (36), (31), (29), (23), (15), (10), (8), (3), (3), (2), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN184172
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human CCNA2
Sequence YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGV SLLNPPETLNL
Predicted Reactivity Bovine : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Dog : 90 %, Horse : 90 %, Mouse : 90 %, Rat : 90 %, Chicken : 80 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against CCNA2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name CCNA2
Background Cyclin A is essential for the control of the cell cycle at the G1/S (start) and the G2/M (mitosis) transitions.
Molecular Weight 49 kDa
Gene ID 890
NCBI Accession NM_001237, NP_001228
UniProt P20248
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 432 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Cyclin A2 (CCNA2) (C-Term) antibody WB Suggested Anti-CCNA2 Antibody Titration: 1ug/ml
Positive Control: HepG2 cell lysate
Background publications Wang, Chenivesse, Henglein et al.: "Hepatitis B virus integration in a cyclin A gene in a hepatocellular carcinoma." in: Nature, Vol. 343, Issue 6258, pp. 555-7, 1990 (PubMed).

Validation Images
back to top