Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184172

Cyclin A2 (CCNA2) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CCN1, CCNA, AA408589, Ccn-1, Ccn1, Ccna, CycA2, Cyca, cb671, chunp6924, wu:fi36f03, CYCA, Cyclin-A2, ccna2, ccn1, ccna, ccna1
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN184172
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CCNA2 antibody: synthetic peptide directed towards the C terminal of human CCNA2
Sequence YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGV SLLNPPETLNL
Predicted Reactivity Bovine : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Dog : 91%, Horse : 91%, Mouse : 91%, Rat : 91%, Chicken : 83%, Zebrafish : 81%
Characteristics This is a rabbit polyclonal antibody against CCNA2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name CCNA2
Background Cyclin A is essential for the control of the cell cycle at the G1/S (start) and the G2/M (mitosis) transitions.
Molecular Weight 49kDa
Gene ID 890
NCBI Accession NP_001228, NM_001237
UniProt P20248
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CCNA2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wang, Chenivesse, Henglein et al.: "Hepatitis B virus integration in a cyclin A gene in a hepatocellular carcinoma." in: Nature, Vol. 343, Issue 6258, pp. 555-7, 1990 (PubMed).

Alternatives for antigen "Cyclin A2 (CCNA2)", type "Antibodies"
Hosts (81), (65)
Reactivities (122), (52), (37), (29), (5), (2), (2), (2), (1), (1)
Applications (117), (56), (39), (30), (27), (21), (14), (11), (10), (3), (3), (2), (1), (1), (1)
Conjugates (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (19), (11), (2), (2), (2), (1), (1), (1)
Beacon